Recombinant human IL2 Receptor beta/p75 protein (Active) (ab174003)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Biological Activity, ELISA, Functional Studies
Description
-
Product name
Recombinant human IL2 Receptor beta/p75 protein (Active)
See all IL2 Receptor beta/p75 proteins and peptides -
Biological activity
Measured by its binding ability in SPR assay. ab174003 captured on CM5 chip via anti-His antibody, can bind Human IL-2, Tag Free with an affinity constant of 0.525 µM.
Measured by its binding ability in SPR assay. ab174003 captured on CM5 chip via anti-His antibody, can bind Human IL-15, Tag Free with an affinity constant of 21.7 nM.
Measured by its binding ability in BLI assay. Loaded ab174003 on HIS1K Biosensor, can bind Human IL-2, Tag Free with an affinity constant of 0.46 μM as determined in BLI assay (ForteBio Octet Red96e).
Measured by its inhibitory action in a cell based assay. ab174003 inhibits the IL-15-dependent proliferation of Mo7e cells. The EC50 for this effect is 0.38-0.45 µg/mL.
-
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCEL LPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKP FENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGH TWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQP LAFRTKPAALGKD -
Predicted molecular weight
25 kDa including tags -
Amino acids
27 to 239 -
Tags
His tag C-Terminus -
Additional sequence information
NM_000878. Extracellular domain.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab174003 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Biological Activity
ELISA
Functional Studies
-
Form
Lyophilized -
Additional notes
This product was previously labelled as IL2 Receptor beta.
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Reconstitute for long term storage.
pH: 7.40
Constituents: 5% Trehalose, 95% PBSThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- CD122
- CD122 antigen
- High affinity IL 2 receptor beta subunit
see all -
Function
Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 4 subfamily.
Contains 1 fibronectin type-III domain. -
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation. -
Cellular localization
Membrane. - Information by UniProt
Images
-
ab174003 inhibits the IL-15-dependent proliferation of Mo7e cells. The EC50 for this effect is 0.38-0.45 µg/mL.
-
Loaded ab174003 on HIS1K Biosensor, can bind Human IL-2, Tag Free with an affinity constant of 0.46 μM as determined in BLI assay (ForteBio Octet Red96e).
-
ab174003 captured on CM5 chip via anti-His antibody, can bind Human IL-15, Tag Free with an affinity constant of 21.7 nM as determined in a SPR assay (Biacore T200).
-
ab174003 captured on CM5 chip via anti-His antibody, can bind Human IL-2, Tag Free with an affinity constant of 0.525 µM as determined in a SPR assay (Biacore T200).
-
SDS-PAGE of reduced ab174003 stained overnight with Coomassie Blue. The protein migrates as 35-45 kDa due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab174003 has not yet been referenced specifically in any publications.