Bioactive grade

Recombinant human IL2 Receptor beta/p75 protein (ab174003)

Description

  • Product name

    Recombinant human IL2 Receptor beta/p75 protein
    See all IL2 Receptor beta/p75 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e Human megakaryocytic leukemic cells.
    The ED50 for this effect is typically 0.5 - 2.5 µg/mL in the presence of 4.0 ng/mL of recombinant Human IL-15.

  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCEL LPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKP FENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGH TWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQP LAFRTKPAALGKD
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      27 to 239
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NM_000878. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab174003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as IL2 Receptor beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Reconstitute for long term storage.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD122
    • CD122 antigen
    • High affinity IL 2 receptor beta subunit
    • High affinity IL 2 receptor subunit beta
    • High affinity IL-2 receptor subunit beta
    • IL-2 receptor subunit beta
    • IL-2R subunit beta
    • IL-2RB
    • IL15RB
    • IL2 receptor
    • IL2RB
    • IL2RB_HUMAN
    • Interleukin 2 receptor beta
    • Interleukin-2 receptor subunit beta
    • P70 75
    • P70-75
    • P7075
    • p75
    see all
  • Function

    Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Human IL-2 R beta, His Tag (SPR verified) captured on CM5 chip via anti-His antibody, can bind Human IL-15, Tag Free with an affinity constant of 21.7 nM as determined in a SPR assay (Biacore T200).
  • Human IL-2 R beta, His Tag (SPR verified) captured on CM5 chip via anti-His antibody, can bind Human IL-2, Tag Free with an affinity constant of 0.525 µM as determined in a SPR assay (Biacore T200).
  • Human IL-2 R beta, His Tag (SPR verified) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • SDS-PAGE analysis of reduced ab174003 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 40 kDa due to glycosylation.

References

ab174003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up