For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-il2-receptor-betap75-protein-fc-chimera-ab84068.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines Interleukins
Share by email

Recombinant human IL2 Receptor beta/p75 protein (Fc Chimera) (ab84068)

  • Datasheet
Submit a review Q&A (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Suitable for: SDS-PAGE

Description

  • Product name

    Recombinant human IL2 Receptor beta/p75 protein (Fc Chimera)
    See all IL2 Receptor beta/p75 proteins and peptides
  • Biological activity

    ab84068 bound to protein A sepharose beads is able to pull down its ligand, IL2.
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

    P14784
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      Theoretical Sequence: AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWP DRRRWNQ TCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREG VRWRVMAI QDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYF ERHLEFEART LSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVR VKPLQGEFTTW SPWSQPLAFRTKPAALGIPKVDKKVEPKSCDKTHTCP PCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALH NHYTQKSLSLSPGK
    • Amino acids

      27 to 237
    • Additional sequence information

      DNA sequence encoding the signal peptide and extracellular domain of human IL 2R beta (aa 1-237) was fused to the Fc region of human IgG1 (aa93-330). Protein expressed in modified human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab84068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilized
  • Additional notes

    ab84068 bound to protein A sepharose beads is able to pull down its ligand, IL2.

     This product was previously labelled as IL2 Receptor beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituents: 1% Human serum albumin, 10% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names

    • CD122
    • CD122 antigen
    • High affinity IL 2 receptor beta subunit
    • High affinity IL 2 receptor subunit beta
    • High affinity IL-2 receptor subunit beta
    • IL-2 receptor subunit beta
    • IL-2R subunit beta
    • IL-2RB
    • IL15RB
    • IL2 receptor
    • IL2RB
    • IL2RB_HUMAN
    • Interleukin 2 receptor beta
    • Interleukin-2 receptor subunit beta
    • P70 75
    • P70-75
    • P7075
    • p75
    see all
  • Function

    Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P14784 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab84068? Please let us know so that we can cite the reference in this datasheet.

    ab84068 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-3 of 3 Abreviews or Q&A

    Question

    Does the antibody bind to the extracellular domain of CD122 and is it
    known whether that antibody leave the receptor fully functional (IL-2
    binding, internalising) once bound?
    All the best

    Read More

    Abcam community

    Verified customer

    Asked on Jun 25 2013

    Answer

    The ab25227 antibody specificity on the datasheet shows the products does not block the receptor so it means the receptor is fully functional.The epitope of this antibody has not been determined so I am sorry we are unable to confirm which part of domain this antibody binds.

    The antibody ab171228; https://www.abcam.com/il2-receptor-beta-tm-beta1-antibody-low-endotoxin-azide-free-ab171228.html is known to inhibit the iL2 to receptor binding.

    Read More

    Padamjeet Singh

    Abcam Scientific Support

    Answered on Jun 25 2013

    Question

    Inquiry: Hi, I'm looking to see if it is at all possible to get this material (ab84068) without added albumin. The carrier interferes with the assay I am trying to do. I don't need much, and I am local, and I am willing to have the protein in whatever format is easiest, as long as there is no added protein. Can you give me an idea if this is at all possible? Thanks, Heather

    Read More

    Abcam community

    Verified customer

    Asked on May 15 2012

    Answer

    Thank you for contacting us.

    We cuurrently do not have this product in an albumin free state. The albumin is added by the originating lab as stabilizer and lyophilised prior to shipping. I am sorry for any inconvenience this may cause.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on May 15 2012

    Question

    Does this protein retain function, in particular can the IL2 receptor beta still bind protein?

    Read More

    Abcam community

    Verified customer

    Asked on Mar 12 2012

    Answer

    This purifed IL-2beta receptor protein does bind IL-2 as shown by its ability to precipitate it whenab84068 is bound to protein A beads in an immunoprecipitation experiment. However it is not a fully functional receptor as ab84068 only contains the extracellular region of the protein.



    I hope this helps. If you have any further questions please feel free to contact me again.

    Read More

    Abcam Scientific Support

    Answered on Mar 12 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.