Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCR HVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPE PVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTT DFGLTMLF
    • Molecular weight

      18 kDa
    • Amino acids

      1 to 158

Associated products

Specifications

Our Abpromise guarantee covers the use of ab151822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It was lyophilized from an 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.

    Previously labelled as IL36 alpha. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • FIL1
    • FIL1 epsilon
    • FIL1(EPSILON)
    • FIL1E
    • IL 1 epsilon
    • IL 1F6
    • IL 1H1
    • IL-1 epsilon
    • IL-1F6
    • IL1E
    • IL1F6
    • IL1F6_HUMAN
    • IL1RP2
    • IL36 alpha
    • IL36A
    • Interleukin 1 epsilon
    • Interleukin 1 family member 6
    • Interleukin 1 family member 6 (epsilon)
    • Interleukin 36 alpha
    • Interleukin-1 epsilon
    • Interleukin-1 family member 6
    • MGC129552
    • MGC129553
    • MGC151479
    • MGC151481
    • OTTMUSP00000012798
    • RP23-176J12.4
    see all
  • Tissue specificity

    Expressed in immune system and fetal brain, but not in other tissues tested or in multiple hematopoietic cell lines.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up