Bioactive grade

Recombinant human IL36 alpha/IL-1F6 protein (Active) (ab243775)

Description

  • Product name

    Recombinant human IL36 alpha/IL-1F6 protein (Active)
    See all IL36 alpha/IL-1F6 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCR HVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPE PVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTT DFGLTMLF
    • Predicted molecular weight

      18 kDa
    • Amino acids

      1 to 158

Specifications

Our Abpromise guarantee covers the use of ab243775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    2X PBS, 0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • FIL1
    • FIL1 epsilon
    • FIL1(EPSILON)
    • FIL1E
    • IL 1 epsilon
    • IL 1F6
    • IL 1H1
    • IL-1 epsilon
    • IL-1F6
    • IL1E
    • IL1F6
    • IL1F6_HUMAN
    • IL1RP2
    • IL36 alpha
    • IL36A
    • Interleukin 1 epsilon
    • Interleukin 1 family member 6
    • Interleukin 1 family member 6 (epsilon)
    • Interleukin 36 alpha
    • Interleukin-1 epsilon
    • Interleukin-1 family member 6
    • MGC129552
    • MGC129553
    • MGC151479
    • MGC151481
    • OTTMUSP00000012798
    • RP23-176J12.4
    see all
  • Tissue specificity

    Expressed in immune system and fetal brain, but not in other tissues tested or in multiple hematopoietic cell lines.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS Page analysis of IL-36 alpha/IL-1F6 with ab243775.

References

ab243775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up