For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-il37-protein-active-ab224789.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Recombinant human IL37 protein (Active) (ab224789)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Suitable for: Functional Studies, SDS-PAGE, HPLC

You may also be interested in

ELISA
Product image
Human IL-37 ELISA Kit (ab213798)

View more associated products

Description

  • Product name

    Recombinant human IL37 protein (Active)
    See all IL37 proteins and peptides
  • Biological activity

    Measured by its ability to bind Interleukin-18 Binding Protein isoform a (IL-18 BPa) in functional ELISA.

  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% by SDS-PAGE gel and HPLC analyses.
  • Expression system

    Escherichia coli
  • Accession

    Q9NZH6
  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFAL ASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLA AQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFE NRKHIEFSFQ PVCKAEMSPS EVSD
    • Predicted molecular weight

      19 kDa
    • Amino acids

      46 to 218
    • Additional sequence information

      This product is the mature full length protein from aa 46 to 218. The propeptide is not included.

Associated products

  • Related Products

    • Anti-IL37 antibody (ab153889)

Specifications

Our Abpromise guarantee covers the use of ab224789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • FIL1
    • FIL1 zeta
    • FIL1(ZETA)
    • FIL1Z
    • IL 1 zeta
    • IL 1F7
    • IL 1F7b (IL 1H4, IL 1H, IL 1RP1)
    • IL 1H4
    • IL 1RP1
    • IL 1X
    • IL 1X protein
    • IL-1 zeta
    • IL-1F7
    • IL-1H
    • IL-1H4
    • IL-1RP1
    • IL-1X
    • IL-37
    • IL1F7
    • IL1F7 (canonical product IL 1F7b)
    • IL1F7_HUMAN
    • IL1H4
    • IL1RP1
    • Interleukin 1 family member 7
    • interleukin 1 family, member 7 (zeta)
    • Interleukin 1 homolog 4
    • Interleukin 1 related protein
    • Interleukin 1 superfamily z
    • Interleukin 1 zeta
    • Interleukin 37
    • Interleukin-1 family member 7
    • Interleukin-1 homolog 4
    • Interleukin-1 zeta
    • Interleukin-1-related protein
    • Interleukin-23
    see all
  • Function

    Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
  • Tissue specificity

    In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Post-translational
    modifications

    Proteolytically converted to the mature form by CASP1.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Secreted. Stimulation with IL1B leads to colocalization with SMAD3 mostly in perinuclear regions. Only the CASP1-cleaved mature form translocates into the nucleus upon LPS stimulation.
  • Target information above from: UniProt accession Q9NZH6 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab224789? Please let us know so that we can cite the reference in this datasheet.

    ab224789 has been referenced in 1 publication.

    • Zhou P  et al. Interleukin 37 Suppresses M1 Macrophage Polarization Through Inhibition of the Notch1 and Nuclear Factor Kappa B Pathways. Front Cell Dev Biol 8:56 (2020). PubMed: 32117982

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab224789.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.