Recombinant human IL37 protein (Active) (ab224789)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
Description
-
Product name
Recombinant human IL37 protein (Active)
See all IL37 proteins and peptides -
Biological activity
Measured by its ability to bind Interleukin-18 Binding Protein isoform a (IL-18 BPa) in functional ELISA.
-
Purity
> 95 % SDS-PAGE.
Purity is greater than 95% by SDS-PAGE gel and HPLC analyses. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFAL ASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLA AQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFE NRKHIEFSFQ PVCKAEMSPS EVSD -
Predicted molecular weight
19 kDa -
Amino acids
46 to 218 -
Additional sequence information
This product is the mature full length protein from aa 46 to 218. The propeptide is not included.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab224789 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- FIL1
- FIL1 zeta
- FIL1(ZETA)
see all -
Function
Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. -
Tissue specificity
In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart. -
Sequence similarities
Belongs to the IL-1 family. -
Post-translational
modificationsProteolytically converted to the mature form by CASP1. -
Cellular localization
Cytoplasm > cytosol. Nucleus. Secreted. Stimulation with IL1B leads to colocalization with SMAD3 mostly in perinuclear regions. Only the CASP1-cleaved mature form translocates into the nucleus upon LPS stimulation. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab224789 has been referenced in 1 publication.
- Zhou P et al. Interleukin 37 Suppresses M1 Macrophage Polarization Through Inhibition of the Notch1 and Nuclear Factor Kappa B Pathways. Front Cell Dev Biol 8:56 (2020). PubMed: 32117982