Overview

  • Product name

    Recombinant Human ILF2/NF45 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDE TSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIE EVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQD PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQS ALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH YAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT VMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE
    • Molecular weight

      70 kDa including tags
    • Amino acids

      1 to 390
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as ILF2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HGNC:6037
    • ILF 2
    • ilf2
    • ILF2_HUMAN
    • Interleukin enhancer binding factor 2
    • Interleukin enhancer binding factor 2, 45kDa
    • Interleukin enhancer-binding factor 2
    • MGC8391
    • NF 45
    • NF45
    • Nuclear factor of activated T cells 45 kDa
    • Nuclear factor of activated T-cells 45 kDa
    • PRO3063
    see all
  • Function

    Appears to function predominantly as a heterodimeric complex with ILF3. This complex may regulate transcription of the IL2 gene during T-cell activation. It can also promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.
  • Sequence similarities

    Contains 1 DZF domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleolus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132371 stained with Coomassie Blue.

References

ab132371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up