Overview

  • Product name

    Recombinant Human ILP2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      DVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISP EEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAV IDFKQRVFMS
    • Amino acids

      127 to 236
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Baculoviral IAP repeat containing 8
    • Baculoviral IAP repeat containing protein 8
    • Baculoviral IAP repeat-containing protein 8
    • BIRC 8
    • BIRC8
    • BIRC8 protein
    • BIRC8_HUMAN
    • hILP 2
    • hILP2
    • IAP like protein 2
    • IAP-like protein 2
    • ILP 2
    • ILP-2
    • Inhibitor of apoptosis like protein 2
    • Inhibitor of apoptosis-like protein 2
    • Testis specific inhibitor of apoptosis
    • Testis-specific inhibitor of apoptosis
    see all
  • Function

    Protects against apoptosis mediated by BAX.
  • Tissue specificity

    Testis specific in normal tissues.
  • Sequence similarities

    Belongs to the IAP family.
    Contains 1 BIR repeat.
    Contains 1 RING-type zinc finger.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab164973 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up