Bioactive grade

Recombinant human ILT-4 protein (Active) (ab220459)

Description

  • Product name

    Recombinant human ILT-4 protein (Active)
    See all ILT-4 proteins and peptides
  • Biological activity

    Immobilized Human ANGPTL7, His Tag at 5 μg/mL (100 μL/well) can bind ab220459 with a linear range of 0.031-2 μg/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWIT RIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAY PKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQP HARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGV SKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQ PQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQI RGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSI HEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGP SMGSSPPPTGPISTPAGPED QPLTPTGSDPQSGLGRHLGV
    • Predicted molecular weight

      74 kDa including tags
    • Amino acids

      22 to 461
    • Additional sequence information

      Extracellular domain fused with a Human IgG1 Fc tag at the C-terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab220459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD85 antigen-like family member D
    • CD85d
    • CD85d antigen
    • ILT 4
    • ILT-4
    • ILT4
    • Immunoglobulin like transcript 4
    • Immunoglobulin-like transcript 4
    • Leukocyte immunoglobulin like receptor 2
    • Leukocyte immunoglobulin like receptor subfamily B member 2
    • Leukocyte immunoglobulin-like receptor 2
    • Leukocyte immunoglobulin-like receptor subfamily B member 2
    • Leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
    • LILRA6
    • LILRB2
    • LIR 2
    • LIR-2
    • LIR2
    • LIRb
    • LIRB2_HUMAN
    • MIR 10
    • MIR-10
    • MIR10
    • Monocyte/macrophage immunoglobulin like receptor 10
    • Monocyte/macrophage immunoglobulin-like receptor 10
    see all
  • Function

    Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Involved in the down-regulation of the immune response and the development of tolerance. Competes with CD8A for binding to class I MHC antigens. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.
  • Tissue specificity

    Expressed on monocytes and B-cells, and at lower levels on dendritic cells. Detected at low levels in natural killer (NK) cells.
  • Sequence similarities

    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    Contains 3 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues. Dephosphorylated by PTPN6.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE using ab220459. The protein migrates as 110 kDa under reducing condition (SDS-PAGE) due to glycosylation.

References

ab220459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up