Overview

  • Product name
    Recombinant Human ILT-7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQ GTLEAQGYRLDKEGNSMSRHILKTLESENKVKLSIPSMMWEHAGRYHCYY QSPAGWSEPSDPLELVVTAYSRPTLSALPSPVVTSGVNVTLRCASRLGLG RFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYEN NTPYVWSEPSDPLQLLVSGVSRKPSLLTLQGPVVTPGENLTLQCGSDVGY IRYTLYKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHN VSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPM FTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRS SNPYLLSHPSEPLELVVSGATETLNPAQKKSDSKTAPHLQDYTVENLIRM GVAGLVLLFLGILLFEAQHSQRSPPRCSQEANSRKDNAPFRVVEPWEQI
    • Amino acids
      1 to 499
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as LILRA4.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD85 antigen-like family member G
    • CD85g
    • ILT-7
    • ILT7
    • Immunoglobulin like transcript 7
    • Immunoglobulin-like transcript 7
    • Leukocyte immunoglobulin-like receptor subfamily A member 4
    • LILRA4
    • LIRA4_HUMAN
    • MGC129597
    • MGC129598
    see all
  • Function
    May act as receptor for class I MHC antigens. Ligand binding leads to the activation of eosinophils and to the release of RNASE2, IL4 and leukotriene C4.
  • Tissue specificity
    Detected in eosinophils, neutrophils and monocytes.
  • Sequence similarities
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161681 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up