Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLV SPKNPEQKIIKRVIALEGDIVR
    • Amino acids
      31 to 102
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.4.21
    • IMP2
    • IMP2 inner mitochondrial membrane peptidase like (S. cerevisiae)
    • IMP2 inner mitochondrial membrane protease like
    • IMP2 inner mitochondrial membrane protease like (S. cerevisiae)
    • IMP2 like
    • IMP2 like protein
    • IMP2-LIKE
    • Inner mitochondrial membrane peptidase 2 like
    • Mitochondrial inner membrane protease subunit 2
    • OTTHUMP00000207168
    • OTTHUMP00000207189
    see all
  • Relevance
    The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMMPL1 and IMMPL2 are the catalytic subunits of the IMP complex.
  • Cellular localization
    Mitochondrion inner membrane; Single pass membrane protein.

Images

  • ab164472 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up