Description

  • Product name

    Recombinant Human IMP4 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREA LALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMF AKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLI VSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSRLGKRVS DILRYLFPVPKDDSHRVITFANQDDYISFRHHVYKKTDHRNVELTEVGPR FELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVFLSTE
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      1 to 291

Specifications

Our Abpromise guarantee covers the use of ab132910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Brix domain containing protein 4
    • Brix domain-containing protein 4
    • BXDC4
    • D1Wsu40e
    • IMP4
    • IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast)
    • IMP4_HUMAN
    • LRRGT00017
    • MGC19606
    • U3 small nucleolar ribonucleoprotein protein IMP4
    • U3 snoRNP protein 4 homolog
    • U3 snoRNP protein IMP4
    see all
  • Function

    Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.
  • Sequence similarities

    Contains 1 Brix domain.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132910, stained with Coomassie Blue.

References

ab132910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up