Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKW TLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGES ILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESS VKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVK MVLSKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLH LMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTNSPEE SSKALGKNKKVRKDKKRNEH
    • Amino acids
      1 to 320
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IMPACT
    • Impact homolog
    • Impact homolog (mouse)
    • impact RWD domain protein
    • IMPCT_HUMAN
    • Imprinted and ancient gene protein homolog
    • MGC33718
    • Protein IMPACT
    • RWD domain containing 5
    • RWDD5
    see all
  • Function
    Translational regulator that ensures constant high levels of translation under amino acid starvation. Acts by interacting with GCN1/GCN1L1, thereby preventing activation of GCN2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis.
  • Tissue specificity
    Widely expressed. Expressed at high level in brain.
  • Sequence similarities
    Belongs to the IMPACT family.
    Contains 1 RWD domain.
  • Information by UniProt

Images

  • ab163086 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up