Description

  • Product name

    Recombinant human IMPAD1 protein
    See all IMPAD1 proteins and peptides
  • Biological activity

    Specific acitivty > 3300 pmole/min/ug, its ability to dephosphorylate adenosine 3’5’-diphosphate sodium slat at pH 7.5, 25°C.

  • Purity

    > 90 % SDS-PAGE.
    ab202168 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSGRFSLFGLGGEPGGGAAGPAAAADGGT VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGD VLSNRKMFYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTT PKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLGVIHKP FSEYTAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQ TTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKA LGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      34 to 359
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Lumenal domain (NP_060283).

Specifications

Our Abpromise guarantee covers the use of ab202168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Activity Assay

    1. Prepare 1mM PAP in 20mM Tris-HCl (PH 7.5), 15mM MgCl2.
    2. Dilute IMPAD1 various concentration (20ug/ml, 10ug/ml, 5ug/ml) in 20mM Tris-HCl (PH 7.5), 15mM

    MgCl2, containing blank of 20mM Tris-HCl, 15mM MgCl2

    3. Make the Phosphate standard range of 0.31 nmol to 20 nmol per well.

    4. Load 25 ul of 1mM PAP add 25 ul of diluted IMPAD1 to well and load 50 ul of phosphate standard.

    5. Incubate for15 minute at 25°C.

    6. Add 150 ul of Malachite green solution mix and incubate for 15 minute at 25°C.

    7. Read at 650nm.

    - Malachite green solution: Ammonium molybdate 675 mg, Malachite green carbinol hydrochloride 3.3 mg in 50 ml of 1M H2SO4.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Golgi 3 prime phosphoadenosine 5 prime phosphate 3 prime phosphatase
    • Golgi 3-prime phosphoadenosine 5-prime phosphate 3-prime phosphatase
    • Golgi resident PAP phosphatase
    • Golgi-resident PAP phosphatase
    • gPAPP
    • IMP 3
    • IMPA3
    • IMPA3_HUMAN
    • Impad1
    • IMPase 3
    • Inositol 1(or 4) monophosphatase 3
    • Inositol monophosphatase 3
    • Inositol monophosphatase domain containing protein 1
    • Inositol monophosphatase domain-containing protein 1
    • Inositol-1(or 4)-monophosphatase 3
    • Myo inositol monophosphatase A3
    • Myo-inositol monophosphatase A3
    see all
  • Relevance

    Function: May play a role in the formation of skeletal elements derived through endochondral ossification, possibly by clearing adenosine 3',5'-bisphosphate produced by Golgi sulfotransferases during glycosaminoglycan sulfation. Pathway: Polyol metabolism; myo-inositol biosynthesis; myo-inositol from D-glucose 6-phosphate: step 2/2. Disease: Chondrodysplasia with joint dislocations, GPAPP type Similarity: Belongs to the inositol monophosphatase family. PTM: Contains N-linked glycan resistant to endoglycosydase H.
  • Cellular localization

    Membrane; Single-pass membrane protein

Images

  • 15% SDS-PAGE analysis of 3 µg ab202168.

References

ab202168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up