Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSGRFSLFGLGGEPGGGAAGPAAAADGGT VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGD VLSNRKMFYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTT PKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLGVIHKP FSEYTAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQ TTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKA LGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
    • Molecular weight

      38 kDa including tags
    • Amino acids

      34 to 359
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 8.00
    Constituents: 12.01% Urea, 0.32% Tris HCl, 20% Glycerol

General Info

  • Alternative names

    • Golgi 3 prime phosphoadenosine 5 prime phosphate 3 prime phosphatase
    • Golgi 3-prime phosphoadenosine 5-prime phosphate 3-prime phosphatase
    • Golgi resident PAP phosphatase
    • Golgi-resident PAP phosphatase
    • gPAPP
    • IMP 3
    • IMPA3
    • IMPA3_HUMAN
    • Impad1
    • IMPase 3
    • Inositol 1(or 4) monophosphatase 3
    • Inositol monophosphatase 3
    • Inositol monophosphatase domain containing protein 1
    • Inositol monophosphatase domain-containing protein 1
    • Inositol-1(or 4)-monophosphatase 3
    • Myo inositol monophosphatase A3
    • Myo-inositol monophosphatase A3
    see all
  • Relevance

    Function: May play a role in the formation of skeletal elements derived through endochondral ossification, possibly by clearing adenosine 3',5'-bisphosphate produced by Golgi sulfotransferases during glycosaminoglycan sulfation. Pathway: Polyol metabolism; myo-inositol biosynthesis; myo-inositol from D-glucose 6-phosphate: step 2/2. Disease: Chondrodysplasia with joint dislocations, GPAPP type Similarity: Belongs to the inositol monophosphatase family. PTM: Contains N-linked glycan resistant to endoglycosydase H.
  • Cellular localization

    Membrane; Single-pass membrane protein

Images

  • 15% SDS-PAGE analysis of 3 µg ab139247.

References

ab139247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up