Description

  • Product name

    Recombinant Human IMPG2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSS EKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDD RSTHFPE
    • Amino acids

      572 to 678
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Interphotoreceptor matrix proteoglycan 2
    • Interphotoreceptor matrix proteoglycan 200
    • Interphotoreceptor matrix proteoglycan of 200 kDa
    • IPM 200
    • IPM200
    • Sialoprotein associated with cones and rods proteoglycan
    • SPACRCAN
    see all
  • Relevance

    IMPG2 (Interphotoreceptor matrix proteoglycan 2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye. IMPG2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.
  • Cellular localization

    Membrane; Single pass type I membrane protein

Images

  • ab162379 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up