Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MERREEQPGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLM QAQVSPQAWHFSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYES LKAQLFTQITRFASGSKIVLTRLCVALASLALSMMPDAWPCAVADMVRLF QAEDSPVDGQGRCLALLELLTVLPEEFQTSRLPQYRKGLVRTSLAVECGA VFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEVPLQDCEALIQAAFAAL QDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNG DMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHY PVNETTSSLTLTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHK AQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKL GRLLTSSEEPYSWQHTEALLYGFQSIAETIDVNYSDVVPGLIGLIPRISI SNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGNPELSVSSVST LKKICRECKYDLPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSA LQVEEILKNLHSLISPYIQQLEKLAEEIPNPSNKLAIVHILGLLSNLFTT LDISHHEDDHEGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQ VVEAVCAIFEKSVKTLLDDFAPMVPQLCEMLGRMYSTIPQASALDLTRQL VHIFAHEPAHFPPIEALFLLVTSVTLTLFQQGPRDHPDIVDSFMQLLAQA LKRKPDLFLCERLDVKSVFQCAVLALKFPEAPTVKASCGFFTELLPRCGE VESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLL SMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLL CRGLHGTDYTADY
    • Molecular weight

      135 kDa including tags
    • Amino acids

      1 to 963

Specifications

Our Abpromise guarantee covers the use of ab132161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Imp 13
    • Imp13
    • Importin-13
    • Importin13
    • IPO 13
    • Ipo13
    • IPO13_HUMAN
    • Kap 13
    • Kap13
    • Karyopherin 13
    • Karyopherin-13
    • Karyopherin13
    • KIAA0274
    • Late gestation lung 2
    • Late gestation lung 2 protein
    • Lgl2
    • Ran binding protein 13
    • Ran-binding protein 13
    • RanBP 13
    • RanBP13
    see all
  • Function

    Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of UBC9, the RBM8A/MAGOH complex, PAX6 and probably other members of the paired homeobox family. Also mediates nuclear export of eIF-1A, and the cytoplasmic release of eIF-1A is triggered by the loading of import substrates onto IPO13.
  • Tissue specificity

    Expressed in fetal brain, heart, intestine and kidney.
  • Sequence similarities

    Belongs to the importin beta family.
    Contains 14 HEAT repeats.
    Contains 1 importin N-terminal domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132161 stained with Coomassie Blue.

References

ab132161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up