Overview

  • Product name

    Recombinant Human INCENP protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDST DDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFK KSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH
    • Molecular weight

      19 kDa including tags
    • Amino acids

      783 to 918
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab135223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.71% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.75% Sodium chloride

General Info

  • Alternative names

    • binds and activates aurora B and C in vivo and in vitro
    • Chromosomal passenger protein
    • INCE_HUMAN
    • INCENP
    • Inner centromere protein
    • Inner centromere protein antigens 135/155kDa
    • Inner centromere protein antigens 135kD 155kD
    • Inner centromere protein INCENP
    see all
  • Function

    Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Probably acts through association with AURKB or AURKC. Seems to bind directly to microtubules. Controls the kinetochore localization of BUB1.
  • Sequence similarities

    Belongs to the INCENP family.
  • Cellular localization

    Chromosome > centromere. Cytoplasm > cytoskeleton > spindle. Nucleus. Chromosome > centromere > kinetochore. Localizes to inner kinetochore. Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab135223.

References

ab135223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer




I am happy to confirm that ab135223 can be used for Aurora B and Aurora C activation in vitro.


Recombinant human INCENP (783-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag.


Maybe these publications will be helpful when establishing the binding/ activation/ kinase assay for INCENP and Aurora B kinase:


http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4917241/


http://www.sciencedirect.com/science/article/pii/S1097276505012244


http://www.jbc.org/content/277/31/27577.long


Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up