For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-incenp-protein-ab135223.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Chromosome Structure Chromosome
Share by email

Recombinant Human INCENP protein (ab135223)

  • Datasheet
  • SDS
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human INCENP protein (ab135223)

    Key features and details

    • Expression system: Baculovirus infected Sf9 cells
    • Purity: > 90% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: Functional Studies, SDS-PAGE, WB

    Description

    • Product name

      Recombinant Human INCENP protein
    • Purity

      > 90 % SDS-PAGE.

    • Expression system

      Baculovirus infected Sf9 cells
    • Accession

      Q9NQS7
    • Protein length

      Protein fragment
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        AAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDST DDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFK KSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH
      • Predicted molecular weight

        19 kDa including tags
      • Amino acids

        783 to 918
      • Tags

        His tag N-Terminus

    Associated products

    • Related Products

      • Anti-INCENP antibody (ab12183)
      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab135223 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

      Western blot

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 7.00
      Preservative: 1.02% Imidazole
      Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.75% Sodium chloride

    General Info

    • Alternative names

      • binds and activates aurora B and C in vivo and in vitro
      • Chromosomal passenger protein
      • INCE_HUMAN
      • INCENP
      • Inner centromere protein
      • Inner centromere protein antigens 135/155kDa
      • Inner centromere protein antigens 135kD 155kD
      • Inner centromere protein INCENP
      see all
    • Function

      Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Probably acts through association with AURKB or AURKC. Seems to bind directly to microtubules. Controls the kinetochore localization of BUB1.
    • Sequence similarities

      Belongs to the INCENP family.
    • Cellular localization

      Chromosome > centromere. Cytoplasm > cytoskeleton > spindle. Nucleus. Chromosome > centromere > kinetochore. Localizes to inner kinetochore. Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes.
    • Target information above from: UniProt accession Q9NQS7 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human INCENP protein (ab135223)
      SDS-PAGE - Recombinant Human INCENP protein (ab135223)
      SDS-PAGE analysis of ab135223.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab135223? Please let us know so that we can cite the reference in this datasheet.

    ab135223 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Inquiry: Hello, I would like to know whether it is possible to use this INCENP in vitro for activation of Aurora B kinase? The applications tested by Abcam include "functional studies", but I am not sure what it means.

    Read More

    Abcam community

    Verified customer

    Asked on Aug 03 2016

    Answer




    I am happy to confirm that ab135223 can be used for Aurora B and Aurora C activation in vitro.


    Recombinant human INCENP (783-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag.


    Maybe these publications will be helpful when establishing the binding/ activation/ kinase assay for INCENP and Aurora B kinase:


    http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4917241/


    http://www.sciencedirect.com/science/article/pii/S1097276505012244


    http://www.jbc.org/content/277/31/27577.long


    Read More

    Abcam Scientific Support

    Answered on Aug 03 2016

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.