Overview

  • Product name
    Recombinant Human Influenza Virus NS1A Binding Protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL ACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aryl hydrocarbon receptor associated 3
    • DKFZp686K06216
    • FLARA 3
    • FLARA3
    • HSPC068
    • IVNS1ABP
    • IVNS1ABP protein
    • KIAA0850
    • NCX downstream gene 1
    • ND 1
    • ND1
    • NS 1
    • NS1
    • NS1 binding protein
    • NS1 binding protein like protein
    • NS1 BP
    • NS1BP
    see all
  • Relevance
    NS1ABP plays a role in cell division and in the dynamic organization of the actin skeleton as a stabilizer of actin filaments by association with F-actin through Kelch repeats and is known to protect cells from cell death induced by actin destabilization. Interacts with NS/Influenza virus NS1A protein and is believed to mediate the inhibition of its splicing activity. It is usually associated with actin filaments (related to speckle domains) but following Influenza Avirus infection, NS1ABP presents a more diffuse distribution in the nucleoplasm
  • Cellular localization
    Nuclear

Images

  • ab161080 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up