Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNA KKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
    • Amino acids
      1 to 92
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1300013A07Rik
    • Eaf 4
    • Eaf4
    • FLJ20089
    • ING 2
    • ING 3
    • ING2
    • ING3
    • ING3_HUMAN
    • Inhibitor of growth family member 3
    • Inhibitor of growth protein 3
    • MEAF4
    • p47 ING 3
    • p47 ING3
    • p47 regulator protein
    • p47ING3
    • p47ING3 protein
    see all
  • Relevance
    Function: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome. Tissue specificity: Expressed in brain, heart, kidney, liver, lung, ovaries, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Disease: Squamous cell carcinoma of the head and neck Similarity: Belongs to the ING family. Contains 1 PHD-type zinc finger. Domain: The PHD-type zinc finger mediates the binding to H3K4me3.
  • Cellular localization
    Nuclear

Images

  • ab162782 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up