Recombinant Human ING3 protein (ab162782)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human ING3 protein
See all ING3 proteins and peptides -
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceMLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNA KKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
-
Amino acids1 to 92
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab162782 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- 1300013A07Rik
- Eaf 4
- Eaf4
see all -
RelevanceFunction: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome. Tissue specificity: Expressed in brain, heart, kidney, liver, lung, ovaries, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Disease: Squamous cell carcinoma of the head and neck Similarity: Belongs to the ING family. Contains 1 PHD-type zinc finger. Domain: The PHD-type zinc finger mediates the binding to H3K4me3.
-
Cellular localizationNuclear
Images
Datasheets and documents
References
ab162782 has not yet been referenced specifically in any publications.