Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYM SSARSLSSEEKLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRL DTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNS DEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCL CHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
    • Molecular weight

      55 kDa including tags
    • Amino acids

      1 to 249

Specifications

Our Abpromise guarantee covers the use of ab131914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Brain my036 protein
    • Candidate tumor suppressor p33 ING 1 homolog
    • Candidate tumor suppressor p33 ING1 homolog
    • D6Wsu147e
    • D6Xrf92
    • ING 1 like protein
    • ING 4
    • ING1 like protein
    • ING4
    • ING4_HUMAN
    • Inhibitor of growth family member 4
    • Inhibitor of growth family member 4 long isoform
    • Inhibitor of growth protein 4
    • MGC12557
    • my036
    • p29 ING 4
    • p29 ING4
    • p29ING4
    see all
  • Function

    Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may function in DNA replication. May inhibit tumor progression by modulating the transcriptional output of signaling pathways which regulate cell proliferation. Can suppress brain tumor angiogenesis through transcriptional repression of RELA/NFKB3 target genes when complexed with RELA. May also specifically suppress loss of contact inhibition elicited by activated oncogenes such as MYC. Represses hypoxia inducible factor's (HIF) activity by interacting with HIF prolyl hydroxylase 2 (EGLN1).
  • Sequence similarities

    Belongs to the ING family.
    Contains 1 PHD-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab131914 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab131914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up