Description

  • Product name

    Recombinant Human ING5 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYI STVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRL DADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEE DTPKKKKHKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI GCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 240

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1700001C14Rik
    • 1700027H23Rik
    • 1810018M11Rik
    • FLJ23842
    • ING 5
    • Ing5
    • ING5_HUMAN
    • Inhibitor of growth family member 5
    • Inhibitor of growth protein 5
    • p28 ING 5
    • p28 ING5
    • p28ING5
    see all
  • Function

    Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Through chromatin acetylation it may regulate DNA replication and may function as a transcriptional coactivator.
  • Sequence similarities

    Belongs to the ING family.
    Contains 1 PHD-type zinc finger.
  • Domain

    The PHD-type zinc finger mediates the binding to H3K4me3.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab131915 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab131915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up