Description

  • Product name

    Recombinant Human Inhibin beta A protein (denatured)
    See all Inhibin beta A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab202155 was purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGLECDGKVNICCKKQFFVSFKDIGWNDWI IAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKS CCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      311 to 426
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature form, without signal peptide, without propeptide. NP_002183.

Specifications

Our Abpromise guarantee covers the use of ab202155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.24% Tris, 10% Glycerol

General Info

  • Alternative names

    • Activin beta-A chain
    • EDF
    • Erythroid differentiation factor
    • Erythroid differentiation protein
    • Follicle stimulating hormone releasing protein
    • FRP
    • FSH releasing protein
    • INHBA
    • INHBA_HUMAN
    • Inhibin beta A chain
    • Inhibin beta A subunit
    • Inhibin, beta 1
    • Inhibin, beta A (activin A, activin AB alpha polypeptide)
    see all
  • Function

    Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202155 (3µg).

References

ab202155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up