Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKK RPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTK VTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHV FPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGK KKGGGEGGAGADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNI CCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHS TVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV EECGCS
    • Amino acids

      21 to 426
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. (AAH07858.1).

Specifications

Our Abpromise guarantee covers the use of ab219889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA.  Immobilized ab219889 at 10 μg/mL (100 μL/well) can bind Human ACVR2A, Fc Tag with a linear range of 0.625-20 μg/mL.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    Lyophilized from 0.22 µm filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 95% PBS

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution, store under sterile conditions for 3 months (-70oC).

General Info

  • Alternative names

    • Activin beta-A chain
    • EDF
    • Erythroid differentiation factor
    • Erythroid differentiation protein
    • Follicle stimulating hormone releasing protein
    • FRP
    • FSH releasing protein
    • INHBA
    • INHBA_HUMAN
    • Inhibin beta A chain
    • Inhibin beta A subunit
    • Inhibin, beta 1
    • Inhibin, beta A (activin A, activin AB alpha polypeptide)
    see all
  • Function

    Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The bio-activity of latent Activin A was determined by dose-dependent inhibition of the proliferation of MPC-11 cells. The EC50 for this effect is typically 47-66 ng/mL.
  • SDS-PAGE analysis of reduced ab219889 stained overnight with Coomassie Blue.

    The protein has a calculated MW of 13 kDa (mature) & 32 kDa (pro). As a result of glycosylation and Interchain disulfide bond, the protein migrates as 15 kDa (mature) and 43-48 kDa (pro) under reducing (Lane 1) condition, and 27 kDa (mature), 43-48 kDa (pro) and 60 kDa (pro & mature) under non-reducing (Lane 2) condition (SDS-PAGE).

     

  • Immobilized ab219889 at 10 µg/ml can bind Human ACVR2A (Fc tag) with a linear range of 0.625-20 µg/ml.

References

ab219889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up