Recombinant Human Insig2 protein (ab162432)

Overview

  • Product name
    Recombinant Human Insig2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEGETEPPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ IQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHK FKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDR SRSGFGLGVGIAFLATVVTQPLVYNGVYQYTSPDFLYVRSWLPCIFFAGG ITMGNIGRQLAVYECKVIAEKSHQE
    • Amino acids
      1 to 225
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hypothetical protein INSIG2
    • INSIG 2
    • INSIG 2 membrane protein
    • INSIG2 membrane protein
    • Insulin induced gene 2
    • Insulin induced gene 2 protein
    • Insulin induced protein 2
    • MGC26273
    see all
  • Relevance
    Insig2 is highly similar to the protein product encoded by gene Insig1. Both Insig1 protein and Insig2 protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.
  • Cellular localization
    Endoplasmic reticulum

Images

  • ab162432 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up