Description

  • Product name

    Recombinant Human INSL4 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKD GQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCC EVICDDGTSVKLCT
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      26 to 139

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Early placenta insulin like peptide
    • early placenta insulin like peptide (EPIL)
    • Early placenta insulin like peptide A chain
    • Early placenta insulin like peptide B chain
    • Early placenta insulin-like peptide A chain
    • EPIL
    • INSL4
    • INSL4_HUMAN
    • insulin like 4
    • insulin like 4 (placenta)
    • Insulin like peptide 4
    • Insulin-like peptide 4
    • OTTHUMP00000021025
    • Placentin
    see all
  • Function

    May play an important role in trophoblast development and in the regulation of bone formation.
  • Tissue specificity

    Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells.
  • Sequence similarities

    Belongs to the insulin family.
  • Developmental stage

    Highly expressed in the early placenta. Expression of epil peptides in the villous cytotrophoblast is different from that displayed by the syncytiotrophoblast. In fetal tissues it was identified in the perichondrium of all four limbs, vertebrae, and ribs. It was abundant in interbone ligaments.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132848 stained with Coomassie Blue.

References

ab132848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up