Recombinant Human Integrin alpha 1 protein (ab112310)

Submit a review Q&A (1)References (1)
SDS-PAGE - Recombinant Human Integrin alpha 1 protein (ab112310)

    Key features and details

    • Expression system: Wheat germ
    • Suitable for: ELISA, WB, SDS-PAGE

    Description

    • Product name

      Recombinant Human Integrin alpha 1 protein

    • Expression system

      Wheat germ

    • Accession

      P56199

    • Protein length

      Protein fragment

    • Animal free

      No

    • Nature

      Recombinant

      • Species

        Human

      • Sequence

        QFYSSASEYHISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPEL KLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTS TDHLKRGTI

      • Predicted molecular weight

        38 kDa including tags

      • Amino acids

        951 to 1059

    Specifications

    Our Abpromise guarantee covers the use of ab112310 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      ELISA

      Western blot

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • CD 49a
      • CD49 antigen-like family member A
      • CD49a
      • CD49a antigen
      • Integrin alpha-1
      • ITA1_HUMAN
      • Itga 1
      • ITGA1
      • Laminin and collagen receptor
      • Very late activation protein 1
      • VLA 1
      • VLA-1
      • VLA1
      see all

    • Function

      Integrin alpha-1/beta-1 is a receptor for laminin and collagen. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen.

    • Sequence similarities

      Belongs to the integrin alpha chain family.
      Contains 7 FG-GAP repeats.
      Contains 1 VWFA domain.

    • Domain

      The integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage.

    • Cellular localization

      Membrane.
    • Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Integrin alpha 1 protein (ab112310)
      SDS-PAGE - Recombinant Human Integrin alpha 1 protein (ab112310)
      12.5% SDS-PAGE showing ab112310 stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (1)

    Publishing research using ab112310? Please let us know so that we can cite the reference in this datasheet.

    ab112310 has been referenced in 1 publication.

    • Chang BS  et al. Collagen complexes increase the efficiency of iPS cells generated using fibroblasts from adult mice. J Reprod Dev 61:145-53 (2015). WB ; Mouse . PubMed: 25740096

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Does this antibody work in SPR?

    Read More
    Answer

    Thank you very much for your interest in ab112310, anti-Integrin alpha 1.

    To our knowledge, this antibody has not been tested in SPR. Therefore, I can offer a discount off a future purchase if you buy ab112310 now, test it in SPRand submit feedback to us in the form of an Abreview. It doesn't matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody.


    If you are interested in this offer, please follow these steps:

    1. Reply to this e-mail to let me know that you would like to proceed and test ab112310 in SPR. I will then send a discount code. This code must be issued before purchasingthe antibodyso please wait for my reply before ordering.

    2. Purchase ab112310 either by phone, fax, or online (www.abcam.com).

    3. Test it in SPR.

    4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

    5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for a free primary antibodyand the discount code is valid for 4 months after issue.
    Please remember that submission of the Abreview is sufficient for the discount code to become active.

    We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab112310 turns out to be unsuitable for \SPR), you will still receive the discount on your next purchase after your Abreview has been submitted.

    Please let me know if you have any questions about this offer and I would be happy to help you further.

    The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com