Recombinant Human Integrin alpha 4/CD49D protein (ab158773)

Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSI VTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKF GENFASCQAG
    • Amino acids

      98 to 207
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Integrin alpha 4

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 269C wild type
    • Antigen CD49D, alpha 4 subunit of VLA 4 receptor
    • CD49 antigen like family member D
    • CD49 antigen-like family member D
    • CD49d
    • IA4
    • Integrin alpha 4
    • Integrin alpha 4 subunit
    • Integrin alpha IV
    • Integrin alpha-4
    • Integrin alpha-IV
    • Integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA 4 receptor)
    • ITA4_HUMAN
    • ITGA4
    • MGC90518
    • OTTHUMP00000205320
    • Very late activation protein 4 receptor, alpha 4 subunit
    • VLA 4 subunit alpha
    • VLA-4 subunit alpha
    • VLA4
    see all
  • Function

    Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells.
  • Sequence similarities

    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
  • Domain

    The SG1 motif is involved in binding to chondroitin sulfate glycosaminoglycan and cell adhesion.
  • Post-translational
    modifications

    Phosphorylation on Ser-1027 inhibits PXN binding.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab158773 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158773 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

The monoclonal antibody we have used to test the recombinant protein is ITGA4 monoclonal antibody, clone 2C11 which is not currently available for purchase from our catalogue.

In general we don't do epitope mapping for our antibodies and so we do not know exactly which part of the protein the antibody binds to so I am unable to confirm whether it is specific against alpha 4 subunit only.

For indirect ELISA assay, we coat antigen, 200ng/well, in the experiment. Attached are only ELISA protocols which may be of use to you.

Please let me know whether you would be interested in purchasing this antibody. If so, I will contact the lab to see whether it would be possible to add this product to our catalogue.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up