Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online

Recombinant Human Integrin alpha 4/CD49D protein (ab158773)

Submit a review Q&A (1)
SDS-PAGE - Recombinant Human Integrin alpha 4/CD49D protein (ab158773)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: WB, ELISA

    Description

    • Product name

      Recombinant Human Integrin alpha 4/CD49D protein
      See all Integrin alpha 4/CD49D proteins and peptides

    • Expression system

      Wheat germ

    • Protein length

      Protein fragment

    • Animal free

      No

    • Nature

      Recombinant

      • Species

        Human

      • Sequence

        RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSI VTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKF GENFASCQAG

      • Amino acids

        98 to 207

      • Tags

        GST tag N-Terminus

    Specifications

    Our Abpromise guarantee covers the use of ab158773 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Western blot

      ELISA

    • Form

      Liquid

    • Additional notes

      This product was previously labelled as Integrin alpha 4.

       

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • 269C wild type
      • Antigen CD49D, alpha 4 subunit of VLA 4 receptor
      • CD49 antigen like family member D
      • CD49 antigen-like family member D
      • CD49d
      • IA4
      • Integrin alpha 4
      • Integrin alpha 4 subunit
      • Integrin alpha IV
      • Integrin alpha-4
      • Integrin alpha-IV
      • Integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA 4 receptor)
      • ITA4_HUMAN
      • ITGA4
      • MGC90518
      • OTTHUMP00000205320
      • Very late activation protein 4 receptor, alpha 4 subunit
      • VLA 4 subunit alpha
      • VLA-4 subunit alpha
      • VLA4
      see all

    • Function

      Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells.

    • Sequence similarities

      Belongs to the integrin alpha chain family.
      Contains 7 FG-GAP repeats.

    • Domain

      The SG1 motif is involved in binding to chondroitin sulfate glycosaminoglycan and cell adhesion.

    • Post-translational
      modifications

      Phosphorylation on Ser-1027 inhibits PXN binding.

    • Cellular localization

      Membrane.
    • Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Integrin alpha 4/CD49D protein (ab158773)
      SDS-PAGE - Recombinant Human Integrin alpha 4/CD49D protein (ab158773)
      ab158773 on a 12.5% SDS-PAGE stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab158773? Please let us know so that we can cite the reference in this datasheet.

    ab158773 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a question

    Question

    The recombinant protein has been in-house tested by in-house ELISA with the corresponding monoclonal antibody.

    The result showed that the Tag did not influence the ELISA.

    We would like to know:

    Was the monoclonal used in the above mentioned experiment specific against alpha 4 sub unit (ab158773)

    If yes so , then at what conc. was alpha 4 coated on to the plates for the experiment

    Read More
    Answer

    The monoclonal antibody we have used to test the recombinant protein is ITGA4 monoclonal antibody, clone 2C11 which is not currently available for purchase from our catalogue.

    In general we don't do epitope mapping for our antibodies and so we do not know exactly which part of the protein the antibody binds to so I am unable to confirm whether it is specific against alpha 4 subunit only.

    For indirect ELISA assay, we coat antigen, 200ng/well, in the experiment. Attached are only ELISA protocols which may be of use to you.

    Please let me know whether you would be interested in purchasing this antibody. If so, I will contact the lab to see whether it would be possible to add this product to our catalogue.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com