Recombinant Human Integrin alpha 6 protein (ab158769)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human Integrin alpha 6 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALP LQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQG PGGKVVTCAH -
Amino acids
24 to 133 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab158769 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Alpha6p
- CD49 antigen-like family member F
- CD49f
see all -
Function
Integrin alpha-6/beta-1 is a receptor for laminin on platelets. Integrin alpha-6/beta-4 is a receptor for laminin in epithelial cells and it plays a critical structural role in the hemidesmosome (By similarity). ITGA6:ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed:20682778). ITGA6:ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed:22351760). -
Tissue specificity
Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoforms containing segment X1 are ubiquitously expressed. Isoforms containing segment X1X2 are expressed in heart, kidney, placenta, colon, duodenum, myoblasts and myotubes, and in a limited number of cell lines; they are always coexpressed with the ubiquitous isoform containing segment X1. In some tissues (e.g. Salivary gland), isoforms containing cytoplasmic segment A and isoforms containing segment B are detected while in others, only isoforms containing one cytoplasmic segment are found (segment A in epidermis and segment B in kidney). -
Involvement in disease
Epidermolysis bullosa letalis, with pyloric atresia -
Sequence similarities
Belongs to the integrin alpha chain family.
Contains 7 FG-GAP repeats. -
Post-translational
modificationsIsoforms containing segment A, but not segment B, are the major targets for PMA-induced phosphorylation. Phosphorylation occurs on 'Ser-1103' of isoform alpha-6X1X2A. Phosphorylation is not required for the induction of integrin alpha-6A/beta-1 high affinity but may reduce the affinity for ligand.
In invasive prostate cancer ITGA6 undergoes PLAU-mediated cleavage at residues Arg-634-635-Arg in a time-dependent manner enhancing cell invasion and migration in vitro.
Palmitoylation by DHHC3 enhances stability and cell surface expression. -
Cellular localization
Cell membrane. Cell membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Integrin alpha 6 protein (ab158769)ab158769 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Datasheets and documents
References
ab158769 has not yet been referenced specifically in any publications.
