Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLS SGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKS GR
    • Amino acids

      785 to 886
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha RLC
    • Integrin alpha 4 like
    • Integrin alpha RLC
    • Integrin alpha-9
    • Integrin alpha-RLC
    • ITA9_HUMAN
    • ITGA 4L
    • ITGA 9
    • ITGA4L
    • ITGA9
    • RLC
    see all
  • Function

    Integrin alpha-9/beta-1 is a receptor for VCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin.
  • Tissue specificity

    In airway epithelium, in the basal layer of squamous epithelium, and in smooth muscle, skeletal muscle, and hepatocytes. Abundantly expressed in fetal lung and lung cancers.
  • Sequence similarities

    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab158774 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up