Recombinant human Integrin alpha V + Integrin beta 1 protein (ab220599)

Overview

  • Product name

    Recombinant human Integrin alpha V + Integrin beta 1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence 1
    • Accession
    • Species

      Human
    • Sequence

      NLDVDSPAE YSGPEGSYFG FAVDFFVPSA SSRMFLLVGA PKANTTQPGI VEGGQVLKCD WSSTRRCQPI EFDATGNRDY AKDDPLEFKS HQWFGASVRS KQDKILACAP LYHWRTEMKQ EREPVGTCFL QDGTKTVEYA PCRSQDIDAD GQGFCQGGFS IDFTKADRVL LGGPGSFYWQ GQLISDQVAE IVSKYDPNVY SIKYNNQLAT RTAQAIFDDS YLGYSVAVGD FNGDGIDDFV SGVPRAARTL GMVYIYDGKN MSSLYNFTGE QMAAYFGFSV AATDINGDDY ADVFIGAPLF MDRGSDGKLQ EVGQVSVSLQ RASGDFQTTK LNGFEVFARF GSAIAPLGDL DQDGFNDIAI AAPYGGEDKK GIVYIFNGRS TGLNAVPSQI LEGQWAARSM PPSFGYSMKG ATDIDKNGYP DLIVGAFGVD RAILYRARPV ITVNAGLEVY PSILNQDNKT CSLPGTALKV SCFNVRFCLK ADGKGVLPRK LNFQVELLLD KLKQKGAIRR ALFLYSRSPS HSKNMTISRG GLMQCEELIA YLRDESEFRD KLTPITIFME YRLDYRTAAD TTGLQPILNQ FTPANISRQA HILLDCGEDN VCKPKLEVSV DSDQKKIYIG DDNPLTLIVK AQNQGEGAYE AELIVSIPLQ ADFIGVVRNN EALARLSCAF KTENQTRQVV CDLGNPMKAG TQLLAGLRFS VHQQSEMDTS VKFDLQIQSS NLFDKVSPVV SHKVDLAVLA AVEIRGVSSP DHVFLPIPNW EHKENPETEE DVGPVVQHIY ELRNNGPSSF SKAMLHLQWP YKYNNNTLLY ILHYDIDGPM NCTSDMEINP LRIKISSLQT TEKNDTVAGQ GERDHLITKR DLALSEGDIH TLGCGVAQCL KIVCQVGRLD RGKSAILYVK SLLWTETFMN KENQNHSYSL KSSASFNVIE FPYKNLPIED ITNSTLVTTN VTWGIQPAPM PV
    • Molecular weight

      113 kDa including tags
    • Amino acids

      31 to 992
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (NP_002201).
    Amino Acid Sequence 2
    • Accession
    • Species

      Human
    • Sequence

      QTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEAL KKKGCPPDDI ENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQ LVLRLRSGEPQTFTLKFKRAED YPIDLYYLMDLSYSMKDDLENVKSLG TDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTP AKLRNPCTSEQNCT SPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAV CG SLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSH YYDYPSIA HLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL SANSSNVIQLIIDAYNSLSS EVILENGKLSEGVTISYKSYCKNGVNGT GENGRKCSNISIGDEVQFEISITSNKCPKKDS DSFKIRPLGFTEEVEV ILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHC ECST DEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCE CDNFNC DRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEAS NGQICNGRGICECGVCKC TDPKFQGQTCEMCQTCLGVCAEHKECVQCR AFNKGEKKDTCTQECSYFNITKVESRDKLP QPVQPDPVSHCKEKDVDD CWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGI VLIGLA LLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYE GK
    • Molecular weight

      84 kDa including tags
    • Amino acids

      21 to 728

Specifications

Our Abpromise guarantee covers the use of ab220599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human fibronectin at 10 μg/mL (100 μL/well) can bind ab220599 with a linear range of 0.16-5 μg/mL.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Cellular localization

    Integrin alpha V: Membrane. Integrin beta 1: Cell membrane, sarcolemma. Cell junction. In cardiac muscle, isoform 5 is found in costameres and intercalated disks and Cell membrane. Cell projection, invadopodium membrane. Cell projection, ruffle membrane. Recycling endosome. Melanosome. Cleavage furrow. Cell projection, lamellipodium. Cell projection, ruffle. Cell junction, focal adhesion. Cell surface. Isoform 2 does not localize to focal adhesions. Highly enriched in stage I melanosomes. Located on plasma membrane of neuroblastoma NMB7 cells. In a lung cancer cell line, in prometaphase and metaphase, localizes diffusely at the membrane and in a few intracellular vesicles. In early telophase, detected mainly on the matrix-facing side of the cells. By mid-telophase, concentrated to the ingressing cleavage furrow, mainly to the basal side of the furrow. In late telophase, concentrated to the extending protrusions formed at the opposite ends of the spreading daughter cells, in vesicles at the base of the lamellipodia formed by the separating daughter cells. Colocalizes with ITGB1BP1 and metastatic suppressor protein NME2 at the edge or peripheral ruffles and lamellipodia during the early stages of cell spreading on fibronectin or collagen. Translocates from peripheral focal adhesions sites to fibrillar adhesions in a ITGB1BP1-dependent manner. Enriched preferentially at invadopodia, cell membrane protrusions that correspond to sites of cell invasion, in a collagen-dependent manner. Localized at plasma and ruffle membranes in a collagen-independent manner.

Images

  • Immobilized Human Fibronectin at 2 µg/mL (100 µL/well) can bind Human ITGAV&ITGB1 Heterodimer Protein (His Tag)&Tag Free with a linear range of 0.02-0.313 µg/mL (QC tested).
  • Human ITGAV&ITGB1 Heterodimer Protein (His Tag)&Tag Free on SDS-PAGE under non-reducing (NR) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Immobilized Human fibronectin at 10 μg/mL (100 μL/well) can bind ab220599 with a linear range of 0.16-5 μg/mL.

  • SDS-PAGE analysis of reduced ab220599 stained overnight with Coomassie Blue.

    The reducing protein migrates as 145 kDa (ITGAV) and 116 kDa (ITGB1) respectively due to glycosylation.

References

ab220599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up