Bioactive grade

Recombinant human Integrin alpha V + Integrin beta 5 heterodimer protein (Active) (Biotin) (ab246201)

Description

  • Product name

    Recombinant human Integrin alpha V + Integrin beta 5 heterodimer protein (Active) (Biotin)
  • Biological activity

    Assay #1: Immobilized Human Vitronectin at 5 μg/mL (100 μL/well) can bind ab246201 with a linear range of 0.01-0.156 μg/mL.

    Assay #2: Immobilized Human Fibronectin at 5 μg/mL (100 μL/well) can bind ab246201 with a linear range of 0.156-5 μg/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGI VEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRS KQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVY SIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTL GMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLF MDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDL DQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSM PPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLD KLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEF RDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGE DNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIP LQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLR FSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVS SPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQ WPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVA GQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILY VKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVT TNVTWGIQPAPMPV
    • Predicted molecular weight

      115 kDa including tags
    • Amino acids

      31 to 992
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      NP_002201.1. Extracellular domain. Acidic tail. AviTag sequence GLNDIFEAQKIEWHE.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKN GCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDK TTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTS NFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPL TDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLL VFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLG EKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIIN AYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTAS FEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNS ARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCS GRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCSGHGECHCGE CKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGE MCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIV KDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPN
    • Predicted molecular weight

      82 kDa
    • Amino acids

      24 to 719
    • Additional sequence information

      Basic tail.
  • Conjugation

    Biotin
  • Description

    Recombinant human Integrin alpha V + Integrin beta 5 protein (Active) (Biotin)

Specifications

Our Abpromise guarantee covers the use of ab246201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.87% Sodium chloride

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Cellular localization

    Integrin alpha V: Membrane. Integrin beta 5: Membrane.

Images

  • Biotinylated Human ITGAV & ITGB5 Heterodimer Protein on SDS-PAGE under non-reducing (NR) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • SDS-PAGE - Human Integrin alpha V + Integrin beta 5 protein (Active) (Biotin) (ab246201).

    The gel was stained overnight with Coomassie Blue.

    The reducing protein migrates as 120 kDa and 150kDa (Integrin alpha V) and 90 kDa (Integrin beta 5) respectively due to glycosylation.

  • Immobilized Human Fibronectin at 5 μg/mL (100 μL/well) can bind ab246201 with a linear range of 0.156-5 μg/mL.

  • Immobilized Human Vitronectin at 5 μg/mL (100 μL/well) can bind ab246201 with a linear range of 0.01-0.156 μg/mL.

References

ab246201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up