Bioactive grade

Recombinant human Integrin alpha V + Integrin beta 5 protein (Active) (ab220547)

Description

  • Product name

    Recombinant human Integrin alpha V + Integrin beta 5 protein (Active)
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human vitronectin at 5μg/ml (100 μl/well) can bind ab220547 with a linear range of 0.1-4 μg/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGI VEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRS KQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVY SIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTL GMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLF MDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDL DQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSM PPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLD KLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRD KLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN VCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQ ADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFS VHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWP YKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQ GERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVK SLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTN VTWGIQPAPMPV
    • Predicted molecular weight

      113 kDa including tags
    • Amino acids

      31 to 992
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_002201).
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKN GCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDK TTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTS NFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPL TDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLL VFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLG EKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIIN AYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTAS FEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNS ARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCS GRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCSGHGECHCGE CKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGE MCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIV KDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPN
    • Predicted molecular weight

      82 kDa
    • Amino acids

      24 to 719
    • Additional sequence information

      Extracellular domain (AAH06541).

Specifications

Our Abpromise guarantee covers the use of ab220547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Cellular localization

    Integrin alpha V: Membrane. Integrin beta 5: Membrane.

Images

  • Immobilized Vitronectin at 2 µg/mL (100 µL/well) can bind Human ITGAV&ITGB5 Heterodimer Protein (His Tag)&Tag Free with a linear range of 2-20 ng/mL (QC tested).
  • Human ITGAV&ITGB5 Heterodimer Protein (His Tag)&Tag Free on SDS-PAGE under non-reducing (NR) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Immobilized Human vitronectin at 5μg/ml (100 μl/well) can bind ab220547 with a linear range of 0.1-4 μg/ml.

  • SDS-PAGE analysis of ab220547 stained overnight with Coomassie Blue.

    The protein migrates as 145 kDa (Integrin alpha V) and 100-116 kDa (Integrin beta 5) on a SDS-PAGE gel under reducing conditions due to glycosylation.

References

ab220547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up