Bioactive grade

Recombinant human Integrin alpha V + Integrin beta 8 protein (Active) (ab220467)

Description

  • Product name

    Recombinant human Integrin alpha V + Integrin beta 8 protein (Active)
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab220467 at 5 μg/ml (100 μl/well) can bind biotinylated Human TGF-Beta 1 / TGFB1, His Tag & Avi Tag with a linear range of 1-25 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGI VEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRS KQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVY SIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTL GMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLF MDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDL DQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSM PPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLD KLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRD KLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN VCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQ ADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFS VHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWP YKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQ GERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVK SLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTN VTWGIQPAPMPV
    • Predicted molecular weight

      113 kDa including tags
    • Amino acids

      31 to 992
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Integrin alpha V extracellular domain (NP_002201).
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      EDNRCASSNAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISK GCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPL KKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYV DKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVH RQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLAL DSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFA VQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQV ENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVT GGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCF QCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVY GKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQH CVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQ CLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLR
    • Predicted molecular weight

      77 kDa
    • Amino acids

      43 to 684
    • Additional sequence information

      Integrin beta 8 extracellular domain (NP_002205).

Specifications

Our Abpromise guarantee covers the use of ab220467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.61% Tris, 0.58% Sodium chloride, 0.02% Magnesium chloride, 10% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Cellular localization

    Integrin alpha V: Membrane. Integrin beta 8: Membrane.

Images

  • Human ITGAV&ITGB8 Heterodimer Protein, His Tag&Tag Free on SDS-PAGE under non-reducing (NR) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Immobilized Human Vitronectin at 5 µg/mL (100 µL/well) can bind Human ITGAV&ITGB8 Heterodimer Protein, His Tag&Tag Free with a linear range of 0.313-10 µg/mL.
  • Immobilized Human Fibronectin at 10 µg/mL (100 µL/well) can bind Human ITGAV&ITGB8 Heterodimer Protein, His Tag&Tag Free with a linear range of 0.313-10 µg/mL.
  • Immobilized Human ITGAV & ITGB8 Heterodimer Protein, His Tag&Tag Free at 5 µg/mL (100 µL/well) can bind Biotinylated Human TGF-Beta 1, His,Avitag with a linear range of 0.8-13 ng/mL.
  • SDS-PAGE analysis of ab220467 stained overnight with Coomassie Blue.

    The protein migrates as 145 kDa (Integrin alpha V) and 100-116 kDa (Integrin beta 8) on a SDS-PAGE gel under reducing conditions due to glycosylation.

References

ab220467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up