Recombinant human Integrin alpha V + ITGB6 protein (Active) (ab220583)

Overview

  • Product name

    Recombinant human Integrin alpha V + ITGB6 protein (Active)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence 1
    • Accession
    • Species

      Human
    • Sequence

      FNLDVDSPAE YSGPEGSYFG FAVDFFVPSA SSRMFLLVGA PKANTTQPGI VEGGQVLKCD WSSTRRCQPI EFDATGNRDY AKDDPLEFKS HQWFGASVRS KQDKILACAP LYHWRTEMKQ EREPVGTCFL QDGTKTVEYA PCRSQDIDAD GQGFCQGGFS IDFTKADRVL LGGPGSFYWQ GQLISDQVAE IVSKYDPNVY SIKYNNQLAT RTAQAIFDDS YLGYSVAVGD FNGDGIDDFV SGVPRAARTL GMVYIYDGKN MSSLYNFTGE QMAAYFGFSV AATDINGDDY ADVFIGAPLF MDRGSDGKLQ EVGQVSVSLQ RASGDFQTTK LNGFEVFARF GSAIAPLGDL DQDGFNDIAI AAPYGGEDKK GIVYIFNGRS TGLNAVPSQI LEGQWAARSM PPSFGYSMKG ATDIDKNGYP DLIVGAFGVD RAILYRARPV ITVNAGLEVY PSILNQDNKT CSLPGTALKV SCFNVRFCLK ADGKGVLPRK LNFQVELLLD KLKQKGAIRR ALFLYSRSPS HSKNMTISRG GLMQCEELIA YLRDESEFRD KLTPITIFME YRLDYRTAAD TTGLQPILNQ FTPANISRQA HILLDCGEDN VCKPKLEVSV DSDQKKIYIG DDNPLTLIVK AQNQGEGAYE AELIVSIPLQ ADFIGVVRNN EALARLSCAF KTENQTRQVV CDLGNPMKAG TQLLAGLRFS VHQQSEMDTS VKFDLQIQSS NLFDKVSPVV SHKVDLAVLA AVEIRGVSSP DHVFLPIPNW EHKENPETEE DVGPVVQHIY ELRNNGPSSF SKAMLHLQWP YKYNNNTLLY ILHYDIDGPM NCTSDMEINP LRIKISSLQT TEKNDTVAGQ GERDHLITKR DLALSEGDIH TLGCGVAQCL KIVCQVGRLD RGKSAILYVK SLLWTETFMN KENQNHSYSL KSSASFNVIE FPYKNLPIED ITNSTLVTTN VTWGIQPAPM PV
    • Molecular weight

      113 kDa including tags
    • Amino acids

      31 to 992
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Fused with an acidic tail at the C-terminus and followed by a polyhistidine tag.
    Amino Acid Sequence 2
    • Accession
    • Species

      Human
    • Sequence

      GCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCDTPANLLAKGCQ LNFIENPVSQ VEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQ TLQVHVRQTEDYPVDLYYLMDL SASMDDDLNTIKELGSRLSKEMSKLT SNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIP YFCLPTFGFKHILP LTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRND SL HLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIG QLIDKLVQ NNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNIL QLIISAYEELRSEVELEVLG DTEGLNLSFTAICNNGTLFQHQKKCSHM KVGDTASFSVTVNIPHCERRSRHIIIKPVGLG DALELLVSPECNCDCQ KEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTDS CKEA PDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGN GDCDCG ECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCGKCV CTNPGASGPTCERCPTCG DPCNSKRSCIECHLSAAGQAREECVDKCKL AGATISEEEDFSKDGSVSCSLQGENECLIT FLITTDNEGKTIIHSINE KDCPKPPN
    • Molecular weight

      80 kDa including tags
    • Amino acids

      22 to 707

Specifications

Our Abpromise guarantee covers the use of ab220583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab220583 at 2μg/mL (100 μL/well) can bind Human TGF-Beta 1 / TGFB1, His Tag & Avi Tag with a linear range of 2-39 ng/mL.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 0.58% Sodium chloride, 0.61% Tris, 0.02% Calcium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Cellular localization

    Integrin alpha V: Membrane. ITGB6: Membrane.

Images

  • SDS-PAGE analysis of reduced ab220583 stained overnight with Coomassie Blue.

    The reducing protein migrates as 145 kDa (ITGAV) and 115 kDa (ITGB6) respectively due to glycosylation.

References

ab220583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up