Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKA ETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVI QGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRS FSLSTNLQESLRSKE
    • Molecular weight

      19 kDa
    • Amino acids

      24 to 188
    • Additional sequence information

      This product is for the mature full length protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab200262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity as determined in a viral resistance assay was found to be no less than 1.0 x 108 IU/mg.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 97 % SDS-PAGE.
    Purity is determined by SDS-PAGE and HPLC analyses.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Alpha 2a interferon
    • IFN alpha 2
    • IFN alphaA
    • IFN-alpha-2
    • IFNA
    • Ifna2
    • IFNA2_HUMAN
    • IFNA2B
    • INFA2
    • Interferon
    • Interferon alpha 2a
    • Interferon alpha 2b
    • Interferon alpha A
    • Interferon alpha-2
    • Interferon alpha-A
    • LeIF A
    • LeIFA
    • MGC125764
    • MGC125765
    see all
  • Function

    Produced by macrophages, IFN-alpha have antiviral activities.
  • Sequence similarities

    Belongs to the alpha/beta interferon family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab200262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up