Description

  • Product name

    Recombinant human Interferon gamma protein
    See all Interferon gamma proteins and peptides
  • Biological activity

    The biological activity of recombinant Human IFN gamma was measured in an inhibition assay using the Human K-562 cells. The ED50 for this effect is typically 400 - 600 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    ab209170 is purified by Ion Exchange Chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
    • Predicted molecular weight

      17 kDa
    • Amino acids

      24 to 166
    • Additional sequence information

      This product is the mature full length protein including the propeptide. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab209170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    ab209170 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein. Store in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • IF 1
    • IFG
    • IFI
    • IFN gamma
    • IFN immune
    • IFN, immune
    • IFN-gamma
    • IFNG
    • IFNG_HUMAN
    • Immune interferon
    • Interferon gamma
    • Type II Interferon
    see all
  • Function

    Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
  • Tissue specificity

    Released primarily from activated T lymphocytes.
  • Involvement in disease

    In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
  • Sequence similarities

    Belongs to the type II (or gamma) interferon family.
  • Post-translational
    modifications

    Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up