Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQI VSFYFKLFKN FKDDQSIQKS VETIKEDMNV KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKR KRSQMLFQGR RASQ
    • Molecular weight
      17 kDa
    • Amino acids
      1 to 144

Specifications

Our Abpromise guarantee covers the use of ab9659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 determined by a cytotoxicity assay using HT-29 cells is ≤0.05 ng/mL, corresponding to a specific activity of ≥ 2 x 107 units/mg.

     

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 97 % SDS-PAGE.
    Sterile filtered. Greater than 97% by SDS-PAGE and HPLC analyses.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial prior to opening. Reconstitute in 100 µl 1x PBS, pH 8.0 to a concentration of 1.0 mg/ml. Do not vortex. Long term storage: Follow reconstitution with further dilution in a buffer containing a carrier protein (example; 0.1% BSA). Store working aliquots at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

General Info

  • Alternative names
    • IFG
    • IFI
    • IFN gamma
    • IFN, immune
    • IFN-gamma
    • IFNG
    • IFNG_HUMAN
    • Immune interferon
    • Interferon gamma
    see all
  • Function
    Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
  • Tissue specificity
    Released primarily from activated T lymphocytes.
  • Involvement in disease
    In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
  • Sequence similarities
    Belongs to the type II (or gamma) interferon family.
  • Post-translational
    modifications
    Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • All lanes : Anti-CXCL11 antibody [EPR21755-173] (ab216157) at 1/1000 dilution

    Lane 1 : THP-1 (hman monocytic leukemia cell line) whole cell lysate
    Lane 2 : THP-1 treated with 200 ng/ml interferon-gamma (IFN-gamma, ab9659) and 50 ng/ml lipopolysaccharide (LPS) for 24 hours, then 300 ng/ml Brefeldin A (BFA) was added to the treated cells for 20 hours, whole cell lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/20000 dilution

    Developed using the ECL technique.

    Observed band size: 11 kDa
    why is the actual band size different from the predicted?


    Exposure time: 37 seconds


    Blocking/Dilution: 5% NFDM/TBST

    The expression profile observed is consistent with what has been described in the literature (PMID: 17142784).

  • CXCL11 was immunoprecipitated from 0.35mg of THP-1 (human monocytic leukemia cell line) whole cell lysate with ab216157 at 1/30 dilution. Western blot was performed from the immunoprecipitate using ab216157 at 1/1000 dilution. VeriBlot for IP secondary antibody (HRP) (ab131366), was used as secondary antibody at 1/5000 dilution.

    Lane 1: THP-1 (human monocytic leukemia cell line) treated with 200 ng/ml interferon-gamma (IFN-gamma, ab9659) and 50 ng/ml lipopolysaccharide (LPS) for 24 hours, then added 300 ng/ml Brefeldin A (BFA) for 20 hours, whole cell lysate 10ug (Input).
    Lane 2: ab216157 IP in THP-1 treated with 200 ng/ml interferon-gamma (IFN-gamma, ab9659) and 50 ng/ml lipopolysaccharide (LPS) for 24 hours, then added 300 ng/ml Brefeldin A (BFA) for 20 hours, whole cell lysate. 
    Lane 3: Rabbit monoclonal IgG (ab172730) instead of ab216157 in THP-1 treated with 200 ng/ml interferon-gamma (IFN-gamma, ab9659) and 50 ng/ml lipopolysaccharide (LPS) for 24 hours, then added 300 ng/ml Brefeldin A (BFA) for 20 hours, whole cell lysate.

    Blocking/Dilution buffer: 5% NFDM/TBST

  • All lanes : Anti-IP10 antibody [EPR20764] (ab214668) at 1/1000 dilution

    Lane 1 : Untreated THP-1 (human monocytic leukemia cell line) culture supernatant
    Lane 2 : THP-1 treated with 200 ng/ml interferon-gamma (IFN-gamma, ab9659) and 50 ng/ml lipopolysaccharides (LPS) for 24 hours, culture supernatant

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/100000 dilution

    Developed using the ECL technique.

    Observed band size: 12 kDa why is the actual band size different from the predicted?


    Exposure time: 15 seconds


    Blocking/Dilution buffer: 5% NFDM/TBST.

    IP10 protein secretion can be induced by IFN-gamma treatment (PMID: 11907072).

References

This product has been referenced in:
  • Batra R  et al. RNA-binding protein CPEB1 remodels host and viral RNA landscapes. Nat Struct Mol Biol 23:1101-1110 (2016). Functional Studies ; Human . Read more (PubMed: 27775709) »
  • Wu Z  et al. Oxidative stress modulates complement factor H expression in retinal pigmented epithelial cells by acetylation of FOXO3. J Biol Chem 282:22414-25 (2007). Read more (PubMed: 17558024) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab9659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up