Bioactive grade

Recombinant human Interferon gamma protein (His tag) (ab214608)

Description

  • Product name

    Recombinant human Interferon gamma protein (His tag)
    See all Interferon gamma proteins and peptides
  • Biological activity

    Measured in antiviral assays using WISH human amnion cells infected with vesicular stomatitis virus (VSV). The ED50  is ≤ 0.05 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      24 to 166
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included, but the propeptide is left in (AAH70256.1).

Specifications

Our Abpromise guarantee covers the use of ab214608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    pH: 8
    Constituents: 0.79% Tris HCl, 2.32% Sodium chloride

    0.2µm-filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute vial with 100 µl sterile water to a concentration of 0.1mg/ml. Add 1X PBS to the desired protein concentration. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names

    • IF 1
    • IFG
    • IFI
    • IFN gamma
    • IFN immune
    • IFN, immune
    • IFN-gamma
    • IFNG
    • IFNG_HUMAN
    • Immune interferon
    • Interferon gamma
    • Type II Interferon
    see all
  • Function

    Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
  • Tissue specificity

    Released primarily from activated T lymphocytes.
  • Involvement in disease

    In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
  • Sequence similarities

    Belongs to the type II (or gamma) interferon family.
  • Post-translational
    modifications

    Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up