Recombinant Human intestinal alkaline phosphatase protein (ab114266)

Overview

  • Product name

    Recombinant Human intestinal alkaline phosphatase protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVK ANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
    • Molecular weight

      35 kDa including tags
    • Amino acids

      74 to 162

Specifications

Our Abpromise guarantee covers the use of ab114266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alkaline phosphatase intestinal
    • Alkaline phosphomonoesterase
    • Alpi
    • Glycerophosphatase
    • IAP
    • Intestinal alkaline phosphatase
    • Intestinal-type alkaline phosphatase
    • Kasahara isozyme
    • OTTHUMP00000164357
    • PPBI_HUMAN
    see all
  • Sequence similarities

    Belongs to the alkaline phosphatase family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab114266 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up