Overview

  • Product name
    Recombinant Human Invadolysin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVTTLGPKMAAEWGGGVGYSGSGPGRSRWRWSGSVWVRSVLLLLGGLRAS ATSTPVSLGSSPPCRHHVPSDTEVINKVHLKANHVVKRDVDEHLRIKTVY DKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQ YLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGV PDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYAN LCPNMISTQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRF ADGLPPFNYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVE EARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMTGSHTQNRVLS RITLALMEDTGRQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPL PQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSD CRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGC YQVSCSPQGLKVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWD FCELCPPETDPPATNLTRALPLDLCSCSSSLVVTLWLLLGNLFPLLAGFL LCIWH
    • Amino acids
      1 to 655
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gp63
    • GP63 like
    • INV
    • IX14
    • Leishmanolysin Like Peptidase
    • leishmanolysin-like (metallopeptidase M8 family)
    • LMLN
    • Msp
    see all
  • Relevance
    Invadolysin, also known as Leismanolysin-Like proteinase, is a metalloproteinase of the MA clan, family M8, which is distinguished from the other families of metalloproteinases by an insert in the zinc binding site. The “classical” zinc binding motif of HExxHxxxxH contains an insert of 65 residues in the Leishmania form of Leishmanolysin, and varies from 62-105 residues amongst different parasite leishmanolysin isoforms.
  • Cellular localization
    Cytoplasmic

Images

  • ab164779 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up