Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGE KRCLNPESKAIKNLLKAVSKERSKRSP
    • Molecular weight

      9 kDa including tags
    • Amino acids

      22 to 98
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab138797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 of ab138797 as determined by its ability to chemoattract Human CXCR3 transfected BaF3 mouse proB cells was 0.02-0.06 µg/ml.
  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity > 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Lyophilized ab138797 should be stored at less than -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months. Avoid repeated freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.00
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 µg/ml). This can further be diluted to other aqueous buffers.

General Info

  • Alternative names

    • Interferon gamma induced factor MOB1, mouse, homolog of
    • Interferon gamma induced protein 10
    • 10 kDa interferon gamma induced protein
    • 10 kDa interferon gamma-induced protein
    • C X C motif chemokine 10
    • C7
    • Chemokine (C X C motif) ligand 10
    • Chemokine CXC motif ligand 10
    • Crg 2
    • CRG2
    • CXCL10
    • CXCL10(1-73)
    • CXL10_HUMAN
    • Gamma IP10
    • Gamma-IP10
    • gIP 10
    • GIP10
    • IFI10
    • INP 10
    • INP10
    • Interferon activated gene 10
    • Interferon gamma induced cell line
    • Interferon inducible cytokine IP 10
    • Interferon inducible cytokine IP10
    • IP 10
    • IP-10
    • Mob 1
    • MOB1
    • Protein 10 from interferon (gamma) induced cell line
    • SCYB10
    • Small inducible cytokine B10
    • Small inducible cytokine B10 precursor
    • Small inducible cytokine subfamily B (Cys X Cys) member 10
    • Small inducible cytokine subfamily B CXC member 10
    • Small inducible cytokine subfamily B, member 10
    • Small-inducible cytokine B10
    see all
  • Function

    Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    CXCL10(1-73) is produced by proteolytic cleavage after secretion from keratinocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab138797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab138797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up