Description

  • Product name

    Recombinant Human IP6K1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKP LISREQRFYESLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESE TVEQDDTTEREQPRRKHSRRSLHRSGSGSDHKEEKASLSLETSESSQEAK SPKVELHSHSEVPFQMLDGNSGLSSEKISHNPWSLRCHKQQLSRMRSESK DRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQ STSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNG LDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCL DRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDF AHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      1 to 441
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • ATP:1D myo inositol hexakisphosphate phosphotransferase
    • IHPK1
    • Inositol hexakisphosphate kinase 1
    • Inositol hexaphosphate kinase 1
    • InsP6
    • InsP6 kinase 1
    • Ip6k1
    • IP6K1_HUMAN
    • Itpk6
    • Pi uptake stimulator
    • PiUS
    see all
  • Function

    Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.
  • Sequence similarities

    Belongs to the inositol phosphokinase (IPK) family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

References

ab224848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up