Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQ FYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVD NSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEF EWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQ YKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSA VIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLR RELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHE GQDAGYIFGLQSLIDIVTEISEESGEDYKDDDDKHHHHHH
    • Molecular weight

      51 kDa including tags
    • Amino acids

      1 to 426
    • Tags

      His-DDDDK tag C-Terminus
    • Additional sequence information

      GenBank Accession No. NM_016291

Specifications

Our Abpromise guarantee covers the use of ab198053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    >= 87 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol

General Info

  • Alternative names

    • ATP 1D myo inositol hexakisphosphate phosphotransferase
    • IHPK 2
    • IHPK2
    • Inositol hexakisphosphate kinase 2
    • InsP6 kinase 2
    • Ip6k2
    • IP6K2_HUMAN
    • KIAA0263
    • OTTHUMP00000164824
    • P(i) uptake stimulator
    • P(i)-uptake stimulator
    • Pi uptake stimulator
    • PiUS
    see all
  • Function

    Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.
  • Sequence similarities

    Belongs to the inositol phosphokinase (IPK) family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 10 % SDS-PAGE analysis of 1.8 µg ab198053 with Coomassie staining.

References

ab198053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up