Description

  • Product name

    Recombinant Human IP6K2 protein (Tagged) (Biotin)
    See all IP6K2 proteins and peptides
  • Purity

    >= 89 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQ FYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVD NSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEF EWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQ YKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSA VIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLR RELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHE GQDAGYIFGLQSLIDIVTEISEESGEHHHHHHGGGLNDIFEAQKIEWHE
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      1 to 426
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Enzymatically biotin-labeled using Avitag™ technology at the C terminal.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab198062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol, 0.64% Sodium chloride

General Info

  • Alternative names

    • ATP 1D myo inositol hexakisphosphate phosphotransferase
    • IHPK 2
    • IHPK2
    • Inositol hexakisphosphate kinase 2
    • InsP6 kinase 2
    • Ip6k2
    • IP6K2_HUMAN
    • KIAA0263
    • OTTHUMP00000164824
    • P(i) uptake stimulator
    • P(i)-uptake stimulator
    • Pi uptake stimulator
    • PiUS
    see all
  • Function

    Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.
  • Sequence similarities

    Belongs to the inositol phosphokinase (IPK) family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • All lanes : Primary - None used

    Lane 1 : Recombinant Human IP6K2 protein (Tagged) (Biotin) (ab198062)
    Lane 2 : Control

    Secondary
    All lanes : Streptavidin-HRP

    Observed band size: 52 kDa
    why is the actual band size different from the predicted?

  • 4-20% SDS-PAGE analysis of 3 µg ab198062 with Coomassie staining.

References

ab198062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up