Overview

  • Product name

    Recombinant Human IP6K3 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVR MIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDEN
    • Amino acids

      182 to 275
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as IHPK3, IP6 Kinase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP:1D myo inositol hexakisphosphate phosphotransferase
    • IHPK3
    • Inositol hexakisphosphate kinase 3
    • Inositol hexaphosphate kinase 3
    • InsP6 kinase 3
    • INSP6K3
    • Ip6k3
    • IP6K3_HUMAN
    see all
  • Function

    Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.
  • Tissue specificity

    Detected in brain.
  • Sequence similarities

    Belongs to the inositol phosphokinase (IPK) family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab160661 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up