Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      VDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDL ISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS
    • Molecular weight

      36 kDa including tags
    • Amino acids

      186 to 275

Specifications

Our Abpromise guarantee covers the use of ab152714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AURKC
    • AIE 2
    • Aie1
    • AIE2
    • AIK 3
    • AIK3
    • ARK 3
    • ARK-3
    • ARK3
    • Aur C
    • AurC
    • Aurkc
    • AURKC_HUMAN
    • aurora 3
    • Aurora C
    • Aurora kinase C
    • aurora related kinase 3
    • Aurora-related kinase 3
    • Aurora/Ipl1 related kinase 3
    • Aurora/Ipl1-related kinase 3
    • Aurora/Ipl1/Eg2 protein 2
    • EC 2.7.11.1
    • Serine threonine protein kinase 13
    • serine/threonine kinase 13 (aurora/IPL1 like)
    • serine/threonine protein kinase aurora C
    • Serine/threonine-protein kinase 13
    • Serine/threonine-protein kinase aurora-C
    • SPGF5
    • STK13
    see all
  • Function

    May play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis. May also contribute to the regulation of chromosome segregation and cytokinesis.
  • Tissue specificity

    Isoform 1 and isoform 2 are expressed in testis. Elevated expression levels were seen only in a subset of cancer cells such as HepG2, HuH7 and HeLa cells. Expression is maximum at M phase.
  • Involvement in disease

    Defects in AURKC are the cause of male infertility with large-headed multiflagellar polyploid spermatozoa (MIMPS) [MIM:243060]; also known as infertility associated with multi-tailed spermatozoa and excessive DNA.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Chromosome. Cytoplasm > cytoskeleton > spindle. Distributes in the condensed chromosomes during prophase to metaphase. After entering anaphase, there is a dissociation from separated chromosomes and a redistribution to midzone microtubules, and finally remaines in the midbody during cytokinesis.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152714 stained with Coomassie Blue.

References

ab152714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up