Overview

  • Product name

    Recombinant Human IPT protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGE IVSADSMQVYEGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRN RATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQEMGTEKVIDR KVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHS EFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAA GLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTL ETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVS DVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLC DRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVSPDHNKEP KEKGSPGQNDQELKCSV
    • Molecular weight

      79 kDa including tags
    • Amino acids

      1 to 467

Specifications

Our Abpromise guarantee covers the use of ab132793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2310075G14Rik
    • AI314189
    • AI314635
    • AV099619
    • FLJ20061
    • hGRO1
    • IPP transferase
    • IPPT
    • IPT
    • IPTase
    • Isopentenyl diphosphate:tRNA isopentenyltransferase
    • Isopentenyl-diphosphate:tRNA isopentenyltransferase
    • MGC149242
    • MGC149243
    • mitochondrial
    • MOD5
    • MOD5_HUMAN
    • OTTMUSP00000009314
    • Putative protein TR2IT1
    • RP23-121J14.6
    • TRIT 1
    • TRIT1
    • tRNA dimethylallyltransferase
    • tRNA isopentenylpyrophosphate transferase
    • tRNA isopentenyltransferase
    • tRNA isopentenyltransferase 1
    • tRNA isopentenyltransferase mitochondrial
    see all
  • Function

    Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 of both cytosolic and mitochondrial tRNAs, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).
  • Sequence similarities

    Belongs to the IPP transferase family.
    Contains 1 matrin-type zinc finger.
  • Cellular localization

    Cytoplasm and Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132793 stained with Coomassie Blue.

References

ab132793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up