Description

  • Product name

    Recombinant Human IQGAP1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPEC GETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
    • Amino acids

      611 to 710
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HUMORFA01
    • IQ motif containing GTPase activating protein 1
    • IQGA1_HUMAN
    • Iqgap1
    • KIAA0051
    • p195
    • Ras GTPase activating like protein 1
    • Ras GTPase-activating-like protein IQGAP1
    • RasGAP-like with IQ motifs
    • SAR1
    see all
  • Function

    Binds to activated CDC42 but does not stimulate its GTPase activity. It associates with calmodulin. Could serve as an assembly scaffold for the organization of a multimolecular complex that would interface incoming signals to the reorganization of the actin cytoskeleton at the plasma membrane. May promote neurite outgrowth.
  • Tissue specificity

    Expressed in the placenta, lung, and kidney. A lower level expression is seen in the heart, liver, skeletal muscle and pancreas.
  • Sequence similarities

    Contains 1 CH (calponin-homology) domain.
    Contains 4 IQ domains.
    Contains 1 Ras-GAP domain.
    Contains 1 WW domain.
  • Domain

    Regions C1 and C2 can either interact with nucleotide-free CDC42, or interact together, depending on the phosphorylation state of Ser-1443. When Ser-1443 is not phosphorylated, C1 and C2 interact, which prevents binding of nucleotide-free CDC42 and promotes binding of GTP-bound CDC42. Phosphorylation of Ser-1443 prevents interaction between C1 and C2, which opens the structure of the C-terminus and allows binding and sequestration of nucleotide-free CDC42 on both C1 and C2.
  • Post-translational
    modifications

    Phosphorylation of Ser-1443 by PKC prevents interaction between C1 and C2, allowing binding of nucleotide-free CDC42. Ser-1443 phosphorylation enhances the ability to promote neurite outgrowth.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab152920 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152920 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up